PDB entry 1t40

View 1t40 on RCSB PDB site
Description: Crystal structure of human aldose reductase complexed with NADP and IDD552 at ph 5
Class: oxidoreductase
Keywords: aldose reductase, ternary complex, inhibitor binding, OXIDOREDUCTASE
Deposited on 2004-04-28, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose reductase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t40a_
  • Heterogens: NAP, ID5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t40A (A:)
    masrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq
    eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgk
    effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp
    avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak
    hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca
    llsctshkdypfheef