PDB entry 1t3w

View 1t3w on RCSB PDB site
Description: crystal structure of the e.coli dnag c-terminal domain (residues 434 to 581)
Deposited on 2004-04-28, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.271
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1t3wa_
  • Chain 'B':
    Domains in SCOP 1.71: d1t3wb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t3wA (A:)
    aaesgvsrpvpqlkrttmriligllvqnpelatlvpplenldenklpglglfrelvntcl
    sqpglttgqllehyrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqee
    liarerthglsneerlelwtlnqelakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3wA (A:)
    krttmriligllvqnpelatlvpplenldenklpglglfrelvntclsqpglttgqlleh
    yrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqeeliarerthglsne
    erlelwtlnqelak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t3wB (B:)
    aaesgvsrpvpqlkrttmriligllvqnpelatlvpplenldenklpglglfrelvntcl
    sqpglttgqllehyrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqee
    liarerthglsneerlelwtlnqelakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3wB (B:)
    krttmriligllvqnpelatlvpplenldenklpglglfrelvntclsqpglttgqlleh
    yrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqeeliarerthglsne
    erlelwtlnqelakk