PDB entry 1t3r
View 1t3r on RCSB PDB site
Description: HIV protease wild-type in complex with TMC114 inhibitor
Class: hydrolase
Keywords: hiv-1 protease; drug resistance; thermodynamics; substrate envelope
Deposited on
2004-04-27, released
2005-05-03
The last revision prior to the SCOP 1.75 freeze date was dated
2005-05-03, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.14
AEROSPACI score: 0.96
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1t3ra1 - Chain 'B':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1t3rb1 - Heterogens: PO4, 017, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1t3rA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1t3rB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf