PDB entry 1t3r

View 1t3r on RCSB PDB site
Description: HIV protease wild-type in complex with TMC114 inhibitor
Class: hydrolase
Keywords: hiv-1 protease; drug resistance; thermodynamics; substrate envelope
Deposited on 2004-04-27, released 2005-05-03
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.14
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
    Domains in SCOP 1.75: d1t3ra1
  • Chain 'B':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
    Domains in SCOP 1.75: d1t3rb1
  • Heterogens: PO4, 017, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t3rA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t3rB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrnlltqigctlnf