PDB entry 1t3q

View 1t3q on RCSB PDB site
Description: Crystal structure of quinoline 2-Oxidoreductase from Pseudomonas Putida 86
Class: oxidoreductase
Keywords: qor, molybdenum, mcd, oxidoreductase
Deposited on 2004-04-27, released 2004-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinoline 2-oxidoreductase small subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t3qa1, d1t3qa2
  • Chain 'B':
    Compound: quinoline 2-oxidoreductase large subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72224 (0-End)
      • see remark 999 (464-465)
    Domains in SCOPe 2.06: d1t3qb1, d1t3qb2
  • Chain 'C':
    Compound: quinoline 2-oxidoreductase medium subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t3qc1, d1t3qc2
  • Chain 'D':
    Compound: quinoline 2-oxidoreductase small subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t3qd1, d1t3qd2
  • Chain 'E':
    Compound: quinoline 2-oxidoreductase large subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72224 (0-End)
      • see remark 999 (464-465)
    Domains in SCOPe 2.06: d1t3qe1, d1t3qe2
  • Chain 'F':
    Compound: quinoline 2-oxidoreductase medium subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t3qf1, d1t3qf2
  • Heterogens: SO4, FES, FAD, MCN, SMO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t3qA (A:)
    mqaheesqlmrisatingkprvfyveprmhladalrevvgltgtkigceqgvcgsctili
    dgapmrscltlavqaegcsietveglsqgeklnalqdsfrrhhalqcgfctagmlatars
    ilaenpapsrdevrevmsgnlcrctgyetiidaitdpavaeaarrgev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3qA (A:)
    sqlmrisatingkprvfyveprmhladalrevvgltgtkigceqgvcgsctilidgapmr
    scltlavqaegcsietveglsqgeklnalqdsfrrhhalqcgfctagmlatarsilaenp
    apsrdevrevmsgnlcrctgyetiidaitdpavaeaarrgev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t3qB (B:)
    mmkhevvalkkksigtsvlrredtrlltgrgryiadlvlsgmlhvaslrspfaharivsi
    dvadaqalpgvelvwcgadvaelsqgivatmqvegfqttiqpllangvtrfvgeivavvv
    assraiaedaaqliqveyeelpavtgieaalegearandtlagnvvsrtsrardelapif
    assagvvrgqfscgrvsacpmetrgavaqyewttqqlilwtatqmpsfvrtmvamfcaip
    ehlievrvpdvgggfgqkahlhpeellvcllsralgrpvrwiedrqenflgathakqqrn
    emglafdgdgrflalenrsitdggaynnlpwtqlveshvgnavilgvykvpavseesiav
    atnkcpigayrgvgftagqiaretlidraarqlglspfeirrrnvvmpedfpftnrlgqt
    hregtylqtinlleemvnpeafrqrqaearargkylglgvsvfnevtgtgtrtlsflgtp
    ttthdsatvridptgkvtvttslassgqghettlaqiaadvlgvpasdvviqagstknty
    gfgayasrgavigagsigraasivrervkqlaghlleaasediviedglvhvagvpakgm
    pfaevvgaayfadathppgfdatleatatydpsdlvlangghaaiveidastyatrvtdf
    favedcgtminpmivegqirggiaqaigqtlleeviyddfgqlvtttlmdylipttldvp
    dirirhletpsplvpggikgmgesamisapaavvaavndalahlevvietvpitperifr
    siqerpmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3qB (B:)
    mmkhevvalkkksigtsvlrredtrlltgrgryiadlvlsgmlhvaslrspfaharivsi
    dvadaqalpgvelvwcgadvaelsqgivatmqvegfqttiqpllangvtrfvgeivavvv
    assraiaedaaqliqveyeelpavtgieaalegearandtlagnvvsrtsrardelapif
    assagvvrgqfscgrvsacpmetrgavaqyewttqqlilwtatqmpsfvrtmvamfcaip
    ehlievrvpdvgggfgqkahlhpeellvcllsralgrpvrwiedrqenflgathakqqrn
    emglafdgdgrflalenrsitdggaynnlpwtqlveshvgnavilgvykvpavseesiav
    atnkcpigayrgvgftagqiaretlidraarqlglspfeirrrnvvmpedfpftnrlgqt
    hregtylqtinlleemvnpeafrqrqaearargkylglgvsvfnevtgtgtrtlsflgtp
    ttthdsatvridptgkvtvttslassgqghettlaqiaadvlgvpasdvviqagstknty
    gfgayasrgavigagsigraasivrervkqlaghlleaasediviedglvhvagvpakgm
    pfaevvgaayfadathppgfdatleatatydpsdlvlangghaaiveidastyatrvtdf
    favedcgtminpmivegqirggiaqaigqtlleeviyddfgqlvtttlmdylipttldvp
    dirirhletpsplvpggikgmgesamisapaavvaavndalahlevvietvpitperifr
    siqerp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t3qC (C:)
    mkfpafsyrapaslqeviqvladdpdariiaggqsllpllafrlvypsclvdlrnvself
    eisqsagilsvgamvthfrnktdptvakcvpilpkvlahvahqavrnrgtlggslahada
    gaempflmatlgatmyiassagvrsvsatdfmkghyftdleagevlvrveipipalhwef
    deyarrkgdyalvmaaaglsmqggrcvaarialgaveerahqairandflvgkvidesta
    ataaelategleprsdihgsrdlrlslakaitqrvilkaaqgamyaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3qC (C:)
    mkfpafsyrapaslqeviqvladdpdariiaggqsllpllafrlvypsclvdlrnvself
    eisqsagilsvgamvthfrnktdptvakcvpilpkvlahvahqavrnrgtlggslahada
    gaempflmatlgatmyiassagvrsvsatdfmkghyftdleagevlvrveipipalhwef
    deyarrkgdyalvmaaaglsmqggrcvaarialgaveerahqairandflvgkvidesta
    ataaelategleprsdihgsrdlrlslakaitqrvilkaaqgamy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t3qD (D:)
    mqaheesqlmrisatingkprvfyveprmhladalrevvgltgtkigceqgvcgsctili
    dgapmrscltlavqaegcsietveglsqgeklnalqdsfrrhhalqcgfctagmlatars
    ilaenpapsrdevrevmsgnlcrctgyetiidaitdpavaeaarrgev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3qD (D:)
    sqlmrisatingkprvfyveprmhladalrevvgltgtkigceqgvcgsctilidgapmr
    scltlavqaegcsietveglsqgeklnalqdsfrrhhalqcgfctagmlatarsilaenp
    apsrdevrevmsgnlcrctgyetiidaitdpavaeaarrgev
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1t3qE (E:)
    mmkhevvalkkksigtsvlrredtrlltgrgryiadlvlsgmlhvaslrspfaharivsi
    dvadaqalpgvelvwcgadvaelsqgivatmqvegfqttiqpllangvtrfvgeivavvv
    assraiaedaaqliqveyeelpavtgieaalegearandtlagnvvsrtsrardelapif
    assagvvrgqfscgrvsacpmetrgavaqyewttqqlilwtatqmpsfvrtmvamfcaip
    ehlievrvpdvgggfgqkahlhpeellvcllsralgrpvrwiedrqenflgathakqqrn
    emglafdgdgrflalenrsitdggaynnlpwtqlveshvgnavilgvykvpavseesiav
    atnkcpigayrgvgftagqiaretlidraarqlglspfeirrrnvvmpedfpftnrlgqt
    hregtylqtinlleemvnpeafrqrqaearargkylglgvsvfnevtgtgtrtlsflgtp
    ttthdsatvridptgkvtvttslassgqghettlaqiaadvlgvpasdvviqagstknty
    gfgayasrgavigagsigraasivrervkqlaghlleaasediviedglvhvagvpakgm
    pfaevvgaayfadathppgfdatleatatydpsdlvlangghaaiveidastyatrvtdf
    favedcgtminpmivegqirggiaqaigqtlleeviyddfgqlvtttlmdylipttldvp
    dirirhletpsplvpggikgmgesamisapaavvaavndalahlevvietvpitperifr
    siqerpmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3qE (E:)
    mmkhevvalkkksigtsvlrredtrlltgrgryiadlvlsgmlhvaslrspfaharivsi
    dvadaqalpgvelvwcgadvaelsqgivatmqvegfqttiqpllangvtrfvgeivavvv
    assraiaedaaqliqveyeelpavtgieaalegearandtlagnvvsrtsrardelapif
    assagvvrgqfscgrvsacpmetrgavaqyewttqqlilwtatqmpsfvrtmvamfcaip
    ehlievrvpdvgggfgqkahlhpeellvcllsralgrpvrwiedrqenflgathakqqrn
    emglafdgdgrflalenrsitdggaynnlpwtqlveshvgnavilgvykvpavseesiav
    atnkcpigayrgvgftagqiaretlidraarqlglspfeirrrnvvmpedfpftnrlgqt
    hregtylqtinlleemvnpeafrqrqaearargkylglgvsvfnevtgtgtrtlsflgtp
    ttthdsatvridptgkvtvttslassgqghettlaqiaadvlgvpasdvviqagstknty
    gfgayasrgavigagsigraasivrervkqlaghlleaasediviedglvhvagvpakgm
    pfaevvgaayfadathppgfdatleatatydpsdlvlangghaaiveidastyatrvtdf
    favedcgtminpmivegqirggiaqaigqtlleeviyddfgqlvtttlmdylipttldvp
    dirirhletpsplvpggikgmgesamisapaavvaavndalahlevvietvpitperifr
    siqerp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1t3qF (F:)
    mkfpafsyrapaslqeviqvladdpdariiaggqsllpllafrlvypsclvdlrnvself
    eisqsagilsvgamvthfrnktdptvakcvpilpkvlahvahqavrnrgtlggslahada
    gaempflmatlgatmyiassagvrsvsatdfmkghyftdleagevlvrveipipalhwef
    deyarrkgdyalvmaaaglsmqggrcvaarialgaveerahqairandflvgkvidesta
    ataaelategleprsdihgsrdlrlslakaitqrvilkaaqgamyaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3qF (F:)
    mkfpafsyrapaslqeviqvladdpdariiaggqsllpllafrlvypsclvdlrnvself
    eisqsagilsvgamvthfrnktdptvakcvpilpkvlahvahqavrnrgtlggslahada
    gaempflmatlgatmyiassagvrsvsatdfmkghyftdleagevlvrveipipalhwef
    deyarrkgdyalvmaaaglsmqggrcvaarialgaveerahqairandflvgkvidesta
    ataaelategleprsdihgsrdlrlslakaitqrvilkaaqgamy