PDB entry 1t3o

View 1t3o on RCSB PDB site
Description: Solution structure of CsrA, a bacterial carbon storage regulatory protein
Class: RNA binding protein
Keywords: CsrA, CsrB, CsrC, mostly beta strands, RNA binding protein, beta sheet surface
Deposited on 2004-04-27, released 2005-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon storage regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: CSRA, BSU35370
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33911 (21-94)
      • expression tag (11-20)
    Domains in SCOPe 2.07: d1t3oa1, d1t3oa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t3oA (A:)
    mghhhhhhhhhhssghiegrhmlvlsrkineaiqigadievkviavegdqvklgidapkh
    idihrkeiyltiqeennraaalssdvisalssqkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3oA (A:)
    hssghiegrhmlvlsrkineaiqigadievkviavegdqvklgidapkhidihrkeiylt
    iqeennraaalssdvisalssqkk