PDB entry 1t3n

View 1t3n on RCSB PDB site
Description: structure of the catalytic core of dna polymerase iota in complex with dna and dttp
Deposited on 2004-04-27, released 2004-07-20
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-20, with a file datestamp of 2004-07-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.265
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t3nA (A:)
    srvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrdake
    kcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqsd
    elsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnklla
    klvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfsp
    kilekelgisvaqriqklsfgednspvilsgppqsfseedsfkkcsseveaknkieella
    sllnrvcqdgrkphtvrliirryssekhygresrqcpipshviqklgtgnydvmtpmvdi
    lmklfrnmvnvkmpfhltllsvcfcnlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t3nB (B:)
    srvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrdake
    kcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqsd
    elsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnklla
    klvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfsp
    kilekelgisvaqriqklsfgednspvilsgppqsfseedsfkkcsseveaknkieella
    sllnrvcqdgrkphtvrliirryssekhygresrqcpipshviqklgtgnydvmtpmvdi
    lmklfrnmvnvkmpfhltllsvcfcnlk