PDB entry 1t3l

View 1t3l on RCSB PDB site
Description: Structural Analysis of the Voltage-Dependent Calcium Channel Beta Subunit Functional Core in Complex with Alpha1 Interaction Domain
Class: transport protein
Keywords: protein-peptide complex, SH3 domain, Guanylate Kinase domain
Deposited on 2004-04-27, released 2004-05-25
The last revision prior to the SCOP 1.75 freeze date was dated 2004-05-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydropyridine-sensitive L-type, calcium channel beta-2 subunit
    Species: Oryctolagus cuniculus
    Gene: CACNB2, CACNLB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54288
      • engineered (97)
      • see remark 999 (113-116)
    Domains in SCOP 1.75: d1t3la1, d1t3la2
  • Chain 'B':
    Compound: Voltage-dependent L-type calcium channel alpha-1S subunit
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t3lb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t3lA (A:)
    srpsdsdvsleedreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgm
    aisfeakdflhvkekfnndwwigrlvkegceigfipsrvklenmrlqheqrakefklhsk
    ekrmpffkktehtppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisit
    rvtadislakrsvlnnpskhaiiersntrsslaevqseierifelartlqlvvldadtin
    hpaqlsktslapivvyvkisspkvlqrliksrgksqakhlnvqmvaadklaqcppelfdv
    ildenqledacehladyleaywkathppssnlpnpll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3lA (A:)
    leedreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdf
    lhvkekfnndwwigrlvkegceigfipsrvklenmrlqheqrakefkltppydvvpsmrp
    vvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislakrsvlnnpskhaiie
    rsntrsslaevqseierifelartlqlvvldadtinhpaqlsktslapivvyvkisspkv
    lqrliksrgksqakhlnvqmvaadklaqcppelfdvildenqledacehladyleaywka
    thppss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t3lB (B:)
    qqleedlrgymswitqge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3lB (B:)
    qleedlrgymswitqge