PDB entry 1t3k

View 1t3k on RCSB PDB site
Description: NMR structure of a CDC25-like dual-specificity tyrosine phosphatase of Arabidopsis thaliana
Class: hydrolase
Keywords: CDC25, cell cycle, phosphorylation, plant, HYDROLASE
Deposited on 2004-04-27, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual-specificity tyrosine phosphatase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CDC25
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GY31 (20-151)
      • engineered (91)
    Domains in SCOPe 2.07: d1t3ka_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t3kA (A:)
    mgsshhhhhhssglvprgshmamarsisyitstqllplhrrpniaiidvrdeernydghi
    agslhyasgsfddkishlvqnvkdkdtlvfhsalsqvrgptcarrlvnyldekkedtgik
    nimilergfngweasgkpvcrcaevpckgdca
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3kA (A:)
    mamarsisyitstqllplhrrpniaiidvrdeernydghiagslhyasgsfddkishlvq
    nvkdkdtlvfhsalsqvrgptcarrlvnyldekkedtgiknimilergfngweasgkpvc
    rcaevpckgdca