PDB entry 1t3i

View 1t3i on RCSB PDB site
Description: Structure of slr0077/SufS, the Essential Cysteine Desulfurase from Synechocystis PCC 6803
Class: transferase
Keywords: PLP-binding enzyme, cysteine desulfurase, TRANSFERASE
Deposited on 2004-04-26, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable cysteine desulfurase
    Species: Synechocystis sp. [TaxId:1143]
    Gene: CSD, SLR0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t3ia_
  • Chain 'B':
    Compound: Probable cysteine desulfurase
    Species: Synechocystis sp. [TaxId:1143]
    Gene: CSD, SLR0077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t3ib_
  • Heterogens: 2OS, PLP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t3iA (A:)
    mvalqipslaatvrqdfpilnqeinghplvyldnaatsqkpravleklmhyyendnanvh
    rgahqlsvratdayeavrnkvakfinarspreivytrnateainlvayswgmnnlkagde
    iittvmehhsnlvpwqmvaaktgavlkfvqldeqesfdlehfktllsektklvtvvhisn
    tlgcvnpaeeiaqlahqagakvlvdacqsaphypldvqlidcdwlvasghkmcaptgigf
    lygkeeileamppffgggemiaevffdhfttgelphkfeagtpaiaeaialgaavdyltd
    lgmenihnyevelthylwqglgqipqlrlygpnpkhgdraalasfnvaglhasdvatmvd
    qdgiairsghhctqplhrlfdasgsaraslyfyntkeeidlflqslqatirffsdddftv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3iA (A:)
    pslaatvrqdfpilnqeinghplvyldnaatsqkpravleklmhyyendnanvgahqlsv
    ratdayeavrnkvakfinarspreivytrnateainlvayswgmnnlkagdeiittvmeh
    hsnlvpwqmvaaktgavlkfvqldeqesfdlehfktllsektklvtvvhisntlgcvnpa
    eeiaqlahqagakvlvdacqsaphypldvqlidcdwlvasghkmcaptgigflygkeeil
    eamppffgggemiaevffdhfttgelphkfeagtpaiaeaialgaavdyltdlgmenihn
    yevelthylwqglgqipqlrlygpnpkhgdraalasfnvaglhasdvatmvdqdgiairs
    ghhctqplhrlfdasgsaraslyfyntkeeidlflqslqatirffs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t3iB (B:)
    mvalqipslaatvrqdfpilnqeinghplvyldnaatsqkpravleklmhyyendnanvh
    rgahqlsvratdayeavrnkvakfinarspreivytrnateainlvayswgmnnlkagde
    iittvmehhsnlvpwqmvaaktgavlkfvqldeqesfdlehfktllsektklvtvvhisn
    tlgcvnpaeeiaqlahqagakvlvdacqsaphypldvqlidcdwlvasghkmcaptgigf
    lygkeeileamppffgggemiaevffdhfttgelphkfeagtpaiaeaialgaavdyltd
    lgmenihnyevelthylwqglgqipqlrlygpnpkhgdraalasfnvaglhasdvatmvd
    qdgiairsghhctqplhrlfdasgsaraslyfyntkeeidlflqslqatirffsdddftv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3iB (B:)
    pslaatvrqdfpilnqeinghplvyldnaatsqkpravleklmhyyendnanvahqlsvr
    atdayeavrnkvakfinarspreivytrnateainlvayswgmnnlkagdeiittvmehh
    snlvpwqmvaaktgavlkfvqldeqesfdlehfktllsektklvtvvhisntlgcvnpae
    eiaqlahqagakvlvdacqsaphypldvqlidcdwlvasghkmcaptgigflygkeeile
    amppffgggemiaevffdhfttgelphkfeagtpaiaeaialgaavdyltdlgmenihny
    evelthylwqglgqipqlrlygpnpkhgdraalasfnvaglhasdvatmvdqdgiairsg
    hhctqplhrlfdasgsaraslyfyntkeeidlflqslqatirffs