PDB entry 1t3h

View 1t3h on RCSB PDB site
Description: X-ray Structure of Dephospho-CoA Kinase from E. coli Norteast Structural Genomics Consortium Target ER57
Class: transferase
Keywords: structural genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, TRANSFERASE
Deposited on 2004-04-26, released 2004-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dephospho-coa kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6I9 (0-205)
      • modified residue (0)
      • modified residue (57)
      • modified residue (141)
      • expression tag (206)
    Domains in SCOPe 2.07: d1t3ha1, d1t3ha2
  • Chain 'B':
    Compound: dephospho-coa kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6I9 (0-205)
      • modified residue (0)
      • modified residue (57)
      • modified residue (141)
      • expression tag (206)
    Domains in SCOPe 2.07: d1t3hb1, d1t3hb2
  • Chain 'C':
    Compound: dephospho-coa kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6I9 (0-205)
      • modified residue (0)
      • modified residue (57)
      • modified residue (141)
      • expression tag (206)
    Domains in SCOPe 2.07: d1t3hc1, d1t3hc2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t3hA (A:)
    mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
    adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
    ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
    aiasdvarlhahylqlasqfvsqekpelhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3hA (A:)
    mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
    adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
    ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
    aiasdvarlhahylqlasqfvsqekpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t3hB (B:)
    mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
    adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
    ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
    aiasdvarlhahylqlasqfvsqekpelhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3hB (B:)
    mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
    adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
    ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
    aiasdvarlhahylqlasqfvsqekpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t3hC (C:)
    mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
    adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
    ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
    aiasdvarlhahylqlasqfvsqekpelhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3hC (C:)
    mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmee
    knwlnallhpliqqetqhqiqqatspyvlwvvpllvenslykkanrvlvvdvspetqlkr
    tmqrddvtrehveqilaaqatrearlavaddvidnngapdaiasdvarlhahylqlasqf
    vsqekpe