PDB entry 1t3f

View 1t3f on RCSB PDB site
Description: THREE DIMENSIONAL STRUCTURE OF A HUMANIZED ANTI-IFN-GAMMA FAB (HuZAF) IN P21 21 21 SPACE GROUP
Class: immune system
Keywords: Antibody Engineering, Humanized and Chimeric antibody, FAB, X-ray Structure, Gamma-Interferon, Immune System
Deposited on 2004-04-26, released 2004-10-05
The last revision prior to the SCOP 1.75 freeze date was dated 2004-10-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.174
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Huzaf Antibody Light Chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1t3fa1, d1t3fa2
  • Chain 'B':
    Compound: Huzaf Antibody Heavy Chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1t3fb1, d1t3fb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t3fA (A:)
    diqmtqspstlsasvgdrvtitckasenvdtyvswyqqkpgkapklliygasnrytgvps
    rfsgsgsgtdftltisslqpddfatyycgqsynypftfgqgtkvevkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t3fB (B:)
    evqlvqsgaelkkpgssvkvsckasgyiftsswinwvkqapgqglewigridpsdgevhy
    nqdfkdkatltvdkstntaymelsslrsedtavyycargflpwfadwgqgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc