PDB entry 1t3e

View 1t3e on RCSB PDB site
Description: Structural basis of dynamic glycine receptor clustering
Deposited on 2004-04-26, released 2004-07-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.246
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t3eA (A:)
    hrmspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdg
    yavraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedtelire
    sddgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevev
    nkfpvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddll
    nalnegisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldid
    gvrkiifalpgnpvsavvtcnlfvvpalrkmqgildprptiikarlscdvkldprpeyhr
    ciltwhhqeplpwaqstgnqmssrlmsmrsangllmlppkteqyvelhkgevvdvmvigr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3eA (A:)
    mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
    vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
    dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
    fpvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllna
    lnegisradviitsggvdylkqvldidlhaqihfgrvfmkpglpttfatldidgvrkiif
    alpgnpvsavvtcnlfvvpalrkmqgildprptiikarlscdvkldprpeyhrciltwhh
    qeplpwaqstgnqmslmsmrsangllmlppkteqyvelhkgevvdvmvigrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t3eB (B:)
    hrmspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdg
    yavraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedtelire
    sddgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevev
    nkfpvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddll
    nalnegisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldid
    gvrkiifalpgnpvsavvtcnlfvvpalrkmqgildprptiikarlscdvkldprpeyhr
    ciltwhhqeplpwaqstgnqmssrlmsmrsangllmlppkteqyvelhkgevvdvmvigr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3eB (B:)
    mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
    vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedtvrilvqa
    rpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkfpvvavmstgnell
    npeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnalnegisradviits
    ggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvrkiifalpgnpvsa
    vvtcnlfvvpalrkmqgildprptiikarlscdvkldprpeyhrciltwhhqeplpwaqs
    tgnqmssrlmsmrsangllmlppkteqyvelhkgevvdvmvigrl