PDB entry 1t3d

View 1t3d on RCSB PDB site
Description: Crystal structure of Serine Acetyltransferase from E.coli at 2.2A
Deposited on 2004-04-26, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t3da_
  • Chain 'B':
    Domains in SCOP 1.69: d1t3db_
  • Chain 'C':
    Domains in SCOP 1.69: d1t3dc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t3dA (A:)
    hhhhhhssglvprgshmsceeleivwnnikaeartladcepmlasfyhatllkhenlgsa
    lsymlanklsspimpaiairevveeayaadpemiasaacdiqavrtrdpavdkystplly
    lkgfhalqayrighwlwnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivv
    getaviendvsilqsvtlggtgksggdrhpkiregvmigagakilgnievgrgakigags
    vvlqpvpphttaagvparivgkpdsdkpsmdmdqhfnginhtfeygdgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3dA (A:)
    msceeleivwnnikaeartladcepmlasfyhatllkhenlgsalsymlanklsspimpa
    iairevveeayaadpemiasaacdiqavrtrdpavdkystpllylkgfhalqayrighwl
    wnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivvgetaviendvsilqsv
    tlggtgksggdrhpkiregvmigagakilgnievgrgakigagsvvlqpvpphttaagvp
    arivgkpdsdkpsmdmdqhfng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t3dB (B:)
    hhhhhhssglvprgshmsceeleivwnnikaeartladcepmlasfyhatllkhenlgsa
    lsymlanklsspimpaiairevveeayaadpemiasaacdiqavrtrdpavdkystplly
    lkgfhalqayrighwlwnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivv
    getaviendvsilqsvtlggtgksggdrhpkiregvmigagakilgnievgrgakigags
    vvlqpvpphttaagvparivgkpdsdkpsmdmdqhfnginhtfeygdgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3dB (B:)
    msceeleivwnnikaeartladcepmlasfyhatllkhenlgsalsymlanklsspimpa
    iairevveeayaadpemiasaacdiqavrtrdpavdkystpllylkgfhalqayrighwl
    wnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivvgetaviendvsilqsv
    tlggtgksggdrhpkiregvmigagakilgnievgrgakigagsvvlqpvpphttaagvp
    arivgkpdsdkpsmdmdqhfng
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t3dC (C:)
    hhhhhhssglvprgshmsceeleivwnnikaeartladcepmlasfyhatllkhenlgsa
    lsymlanklsspimpaiairevveeayaadpemiasaacdiqavrtrdpavdkystplly
    lkgfhalqayrighwlwnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivv
    getaviendvsilqsvtlggtgksggdrhpkiregvmigagakilgnievgrgakigags
    vvlqpvpphttaagvparivgkpdsdkpsmdmdqhfnginhtfeygdgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3dC (C:)
    msceeleivwnnikaeartladcepmlasfyhatllkhenlgsalsymlanklsspimpa
    iairevveeayaadpemiasaacdiqavrtrdpavdkystpllylkgfhalqayrighwl
    wnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivvgetaviendvsilqsv
    tlggtgksggdrhpkiregvmigagakilgnievgrgakigagsvvlqpvpphttaagvp
    arivgkpdsdkpsmdmdqhfng