PDB entry 1t38

View 1t38 on RCSB PDB site
Description: human o6-alkylguanine-DNA alkyltransferase bound to DNA containing o6-methylguanine
Class: transferase/DNA
Keywords: alkyltransferase, methyltransferase, DNA repair, helix-turn-helix, transferase/DNA complex
Deposited on 2004-04-25, released 2004-07-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.261
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylated-DNA--protein-cysteine methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: MGMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16455 (Start-187)
      • engineered (156)
    Domains in SCOPe 2.08: d1t38a1, d1t38a2
  • Chain 'B':
    Compound: 5'-d(*gp*cp*cp*ap*tp*gp*(6og)p*cp*tp*ap*gp*tp*a)-3'
  • Chain 'C':
    Compound: 5'-d(*tp*ap*cp*tp*ap*gp*cp*cp*ap*tp*gp*gp*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t38A (A:)
    mrgshhhhhhgsmdkdcemkrttldsplgklelsgceqglheikllgkgtsaadavevpa
    paavlggpeplmqctawlnayfhqpeaieefpvpalhhpvfqqesftrqvlwkllkvvkf
    gevisyqqlaalagnpkaaravggamrgnpvpilipshrvvcssgavgnysgglavkewl
    laheghrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t38A (A:)
    emkrttldsplgklelsgceqglheikllgpeplmqctawlnayfhqpeaieefpvpalh
    hpvfqqesftrqvlwkllkvvkfgevisyqqlaalagnpkaaravggamrgnpvpilips
    hrvvcssgavgnysgglavkewllaheghrl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.