PDB entry 1t37

View 1t37 on RCSB PDB site
Description: design of specific inhibitors of phospholipase a2: crystal structure of the complex formed between group i phospholipase a2 and a designed pentapeptide leu-ala-ile-tyr-ser at 2.6a resolution
Deposited on 2004-04-25, released 2004-05-04
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.191
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t37a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t37A (A:)
    nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
    rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapynddnynidlkarcn