PDB entry 1t35

View 1t35 on RCSB PDB site
Description: crystal structure of a hypothetical protein yvdd- a putative lysine decarboxylase
Class: lyase
Keywords: HYPOTHETICAL PROTEIN YVDD, PUTATIVE LYSINE DECARBOXYLASE, STRUCTURAL GENOMICS TARGET, T833, NYSGXRC, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, LYASE
Deposited on 2004-04-23, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.243
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06986 (0-End)
      • modified residue (0)
      • modified residue (28)
      • modified residue (45)
      • modified residue (53)
      • modified residue (63)
      • modified residue (86)
      • modified residue (93)
      • modified residue (103)
      • modified residue (141-142)
      • modified residue (144)
      • modified residue (175)
    Domains in SCOPe 2.07: d1t35a_
  • Chain 'B':
    Compound: HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06986 (0-End)
      • modified residue (0)
      • modified residue (28)
      • modified residue (45)
      • modified residue (53)
      • modified residue (63)
      • modified residue (86)
      • modified residue (93)
      • modified residue (103)
      • modified residue (141-142)
      • modified residue (144)
      • modified residue (175)
    Domains in SCOPe 2.07: d1t35b_
  • Chain 'C':
    Compound: HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06986 (0-End)
      • modified residue (0)
      • modified residue (28)
      • modified residue (45)
      • modified residue (53)
      • modified residue (63)
      • modified residue (86)
      • modified residue (93)
      • modified residue (103)
      • modified residue (141-142)
      • modified residue (144)
      • modified residue (175)
    Domains in SCOPe 2.07: d1t35c_
  • Chain 'D':
    Compound: HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06986 (0-End)
      • modified residue (0)
      • modified residue (28)
      • modified residue (45)
      • modified residue (53)
      • modified residue (63)
      • modified residue (86)
      • modified residue (93)
      • modified residue (103)
      • modified residue (141-142)
      • modified residue (144)
      • modified residue (175)
    Domains in SCOPe 2.07: d1t35d_
  • Chain 'E':
    Compound: HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06986 (0-End)
      • modified residue (0)
      • modified residue (28)
      • modified residue (45)
      • modified residue (53)
      • modified residue (63)
      • modified residue (86)
      • modified residue (93)
      • modified residue (103)
      • modified residue (141-142)
      • modified residue (144)
      • modified residue (175)
    Domains in SCOPe 2.07: d1t35e_
  • Chain 'F':
    Compound: HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06986 (0-End)
      • modified residue (0)
      • modified residue (28)
      • modified residue (45)
      • modified residue (53)
      • modified residue (63)
      • modified residue (86)
      • modified residue (93)
      • modified residue (103)
      • modified residue (141-142)
      • modified residue (144)
      • modified residue (175)
    Domains in SCOPe 2.07: d1t35f_
  • Chain 'G':
    Compound: HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06986 (0-End)
      • modified residue (0)
      • modified residue (28)
      • modified residue (45)
      • modified residue (53)
      • modified residue (63)
      • modified residue (86)
      • modified residue (93)
      • modified residue (103)
      • modified residue (141-142)
      • modified residue (144)
      • modified residue (175)
    Domains in SCOPe 2.07: d1t35g_
  • Chain 'H':
    Compound: HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06986 (0-End)
      • modified residue (0)
      • modified residue (28)
      • modified residue (45)
      • modified residue (53)
      • modified residue (63)
      • modified residue (86)
      • modified residue (93)
      • modified residue (103)
      • modified residue (141-142)
      • modified residue (144)
      • modified residue (175)
    Domains in SCOPe 2.07: d1t35h_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t35A (A:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqnys
    ypilekkwtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t35A (A:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t35B (B:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqnys
    ypilekkwtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t35B (B:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqny
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t35C (C:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqnys
    ypilekkwtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t35C (C:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqny
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t35D (D:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqnys
    ypilekkwtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t35D (D:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqny
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1t35E (E:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqnys
    ypilekkwtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t35E (E:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqnys
    ypil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1t35F (F:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqnys
    ypilekkwtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t35F (F:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqnys
    ypil
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1t35G (G:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqnys
    ypilekkwtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t35G (G:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqny
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1t35H (H:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqnys
    ypilekkwtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t35H (H:)
    mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
    igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
    aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqny