PDB entry 1t34

View 1t34 on RCSB PDB site
Description: rotation mechanism for transmembrane signaling by the atrial natriuretic peptide receptor
Class: signaling protein,membrane protein
Keywords: receptor-hormone complex; natriuretic peptide receptor; guanylyl-cyclase-coupled receptor; signal transduction; rotation mechanism, signaling protein,membrane protein
Deposited on 2004-04-23, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.237
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Atrial natriuretic peptide receptor A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NPR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t34a_
  • Chain 'B':
    Compound: Atrial natriuretic peptide receptor A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NPR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t34b_
  • Chain 'H':
    Compound: Atrial natriuretic peptide factor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t34A (A:)
    sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
    sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
    alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
    itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
    ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll
    adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv
    tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv
    pkcgfdnedpacnqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t34A (A:)
    sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
    sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
    alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
    itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
    ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll
    adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv
    tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv
    pkcgfd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t34B (B:)
    sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
    sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
    alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
    itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
    ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll
    adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv
    tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv
    pkcgfdnedpacnqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t34B (B:)
    sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
    sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
    alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
    itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
    ldvfgqslksaqqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlklladkk
    fnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgvtgyl
    kidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdvpkcg
    f
    

  • Chain 'H':
    No sequence available.