PDB entry 1t33

View 1t33 on RCSB PDB site
Description: Structural Genomics, The crystal structure of a putative transcriptional repressor (TetR/AcrR family) from Salmonella typhimurim LT2
Deposited on 2004-04-23, released 2004-08-03
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t33A (A:)
    mnipttttkgeqaksqliaaalaqfgeyglhattrdiaalagqniaaityyfgskedlyl
    acaqwiadflgekfrphaekaerlfsqpapdrdairelillacknmimlltqedtvnlsk
    fisreqlsptsayqlvheqvidplhthltrlvaaytgcdandtrmilhthallgevlafr
    lgketillrtgwpqfdeekaeliyqtvtchidlilhgltqrsld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t33A (A:)
    mnipttttkgeqaksqliaaalaqfgeyglhattrdiaalagqniaaityyfgskedlyl
    acaqwiadflgekfrphaekaerlfsqpapdrdairelillacknmimlltqedtvnlsk
    fisreqlsptsayqlvheqvidplhthltrlvaaytgcdandtrmilhthallgevlafr
    lgketillrtgwpqfdeekaeliyqtvtchidlilhgltq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t33B (B:)
    mnipttttkgeqaksqliaaalaqfgeyglhattrdiaalagqniaaityyfgskedlyl
    acaqwiadflgekfrphaekaerlfsqpapdrdairelillacknmimlltqedtvnlsk
    fisreqlsptsayqlvheqvidplhthltrlvaaytgcdandtrmilhthallgevlafr
    lgketillrtgwpqfdeekaeliyqtvtchidlilhgltqrsld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t33B (B:)
    ttkgeqaksqliaaalaqfgeyglhattrdiaalagqniaaityyfgskedlylacaqwi
    adflgekfrphaekaerlfsqpapdrdairelillacknmimlltqedtvnlskfisreq
    lsptsayqlvheqvidplhthltrlvaaytgcdandtrmilhthallgevlafrlgketi
    llrtgwpqfdeekaeliyqtvtchidlilhgltq