PDB entry 1t32

View 1t32 on RCSB PDB site
Description: A Dual Inhibitor of the Leukocyte Proteases Cathepsin G and Chymase with Therapeutic Efficacy in Animals Models of Inflammation
Class: hydrolase
Keywords: INFLAMMATION INHIBITOR SERINE PROTEASE, hydrolase
Deposited on 2004-04-23, released 2005-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.172
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin G
    Species: Homo sapiens [TaxId:9606]
    Gene: Human
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t32a_
  • Heterogens: SO4, OHH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t32A (A:)
    iiggresrphsrpymaylqiqspagqsrcggflvredfvltaahcwgsninvtlgahniq
    rrentqqhitarrairhpqynqrtiqndimllqlsrrvrrnrnvnpvalpraqeglrpgt
    lctvagwgrvsmrrgtdtlrevqlrvqrdrqclrifgsydprrqicvgdrrerkaafkgd
    sggpllcnnvahgivsygkssgvppevftrvssflpwirttmrs