PDB entry 1t2t

View 1t2t on RCSB PDB site
Description: Crystal structure of the DNA-binding domain of intron endonuclease I-TevI with operator site
Class: hydrolase/DNA
Keywords: protein-DNA complex, HYDROLASE/DNA COMPLEX
Deposited on 2004-04-22, released 2004-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intron-associated endonuclease 1
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: ITEVIR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t2ta_
  • Chain 'B':
    Compound: 5'-d(*tp*tp*tp*gp*tp*ap*gp*gp*ap*cp*tp*gp*cp*cp*cp*tp*tp*tp*ap*ap*t)-3'
  • Chain 'C':
    Compound: 5'-d(*ap*ap*tp*tp*ap*ap*ap*gp*gp*gp*cp*ap*gp*tp*cp*cp*tp*ap*cp*ap*a)-3'
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t2tA (A:)
    kalyskpgskngrwnpethkfckcgvriqtsaytcskcrnrsgennsffnhkhsditksk
    isekmkgkkpsnikkiscdgvifdcaadaarhfkissglvtyrvksdkwnwfyina
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2tA (A:)
    kfckcgvriqtsaytcskcrnrsgennsffnhkhsditkskisekmkgkkpsnikkiscd
    gvifdcaadaarhfkissglvtyrvksdkwnwfyin
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.