PDB entry 1t2s

View 1t2s on RCSB PDB site
Description: Structural basis for 3' end recognition of nucleic acids by the Drosophila Argonaute 2 PAZ domain
Class: nucleic acid binding protein/dna
Keywords: nucleic acid binding protein, dna, nucleic acid binding protein/dna COMPLEX
Deposited on 2004-04-22, released 2004-06-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argonaute 2
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VUQ5 (4-122)
      • cloning artifact (0-3)
    Domains in SCOPe 2.03: d1t2sa_
  • Chain 'B':
    Compound: 5'-d(*cp*tp*cp*ap*c)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t2sA (A:)
    gamampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvn
    glsrapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee
    gqa
    

  • Chain 'B':
    No sequence available.