PDB entry 1t2r

View 1t2r on RCSB PDB site
Description: Structural basis for 3' end recognition of nucleic acids by the Drosophila Argonaute 2 PAZ domain
Class: nucleic acid binding protein/RNA
Keywords: nucleic acid binding protein, RNA, nucleic acid binding protein/RNA complex
Deposited on 2004-04-22, released 2004-06-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Argonaute 2
  Species: Drosophila melanogaster [TaxId:7227]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9VUQ5 (4-122)
    • cloning artifact (0-3)
  Domains in SCOPe 2.04: d1t2ra_
• Chain 'B':
  Compound: 5'-r(*cp*up*cp*ap*c)-3'
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1t2rA (A:)
  gamampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvn
  glsrapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee
  gqa
  

  
  
• Chain 'B':
  No sequence available.