PDB entry 1t2q

View 1t2q on RCSB PDB site
Description: The Crystal Structure of an NNA7 Fab that recognizes an N-type blood group antigen
Class: immune system
Keywords: Fab, glycophorin A, blood group antigen, IMMUNE SYSTEM
Deposited on 2004-04-22, released 2005-06-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.204
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab NNA7 Light Chain
    Species: Mus musculus [TaxId:10090]
    Gene: N92 L chain
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t2qh1
  • Chain 'L':
    Compound: Fab NNA7 Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Gene: N92 IgG2a
    Database cross-references and differences (RAF-indexed):
    • PDB 1T2Q (0-216)
    Domains in SCOPe 2.06: d1t2ql1, d1t2ql2
  • Heterogens: MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1t2qH (H:)
    evqlleesgpglvqpsqslsitctvsgfsltsygvhwvrqspgkglewlgviwsggstdy
    naafisrlsiskdnsksqvffkmnslqaddtaiyycarnrgysyamdswgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2qH (H:)
    evqlleesgpglvqpsqslsitctvsgfsltsygvhwvrqspgkglewlgviwsggstdy
    naafisrlsiskdnsksqvffkmnslqaddtaiyycarnrgysyamdswgqgtsvtvssa
    kttppsvyplapgsasmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t2qL (L:)
    elvmtqsplslpvslgdqasiscrssqslvhssgntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftltisrveaedlgvyycfqgshvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn