PDB entry 1t2p

View 1t2p on RCSB PDB site
Description: Crystal structure of Sortase A from Staphylococcus aureus
Class: hydrolase
Keywords: Sortase, BETA BARREL, transpeptidase, HYDROLASE
Deposited on 2004-04-22, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sortase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: srt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t2pa_
  • Chain 'B':
    Compound: Sortase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: srt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t2pb_
  • Chain 'C':
    Compound: Sortase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: srt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t2pc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t2pA (A:)
    akpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiagh
    tfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqlt
    litcddynektgvwekrkifvatevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2pA (A:)
    kpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiaght
    fidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqltl
    itcddynektgvwekrkifvatevk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t2pB (B:)
    akpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiagh
    tfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqlt
    litcddynektgvwekrkifvatevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2pB (B:)
    akpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiagh
    tfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgdkqltlitcddyn
    ektgvwekrkifvatevk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t2pC (C:)
    akpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiagh
    tfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqlt
    litcddynektgvwekrkifvatevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2pC (C:)
    kpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiaght
    fidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqltl
    itcddynektgvwekrkifvatevk