PDB entry 1t2n

View 1t2n on RCSB PDB site
Description: Structure of a thermostable triple mutant of Bacillus subtilis lipase obtained through directed evolution
Class: hydrolase
Keywords: alpha/beta hydrolase
Deposited on 2004-04-22, released 2004-11-23
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.226
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase
    Species: Bacillus subtilis
    Gene: LIPA, LIP, BSU02700
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37957 (Start-180)
      • engineered (113)
      • engineered (131)
      • engineered (165)
    Domains in SCOP 1.73: d1t2na_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t2nA (A:)
    aehnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvq
    kvldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkappgtdpn
    qkilytsiyssddmivmnylsrldgarnvqihgvghigllyssqvyslikeglngggqnt
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2nA (A:)
    hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
    ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkappgtdpnqk
    ilytsiyssddmivmnylsrldgarnvqihgvghigllyssqvyslikeglngggqntn