PDB entry 1t2m

View 1t2m on RCSB PDB site
Description: Solution Structure Of The Pdz Domain Of AF-6
Class: protein binding
Keywords: Chromosomal translocation, Proto-oncogene, PROTEIN BINDING
Deposited on 2004-04-22, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AF-6 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55196 (1-92)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1t2ma1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t2mA (A:)
    mkepeiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaagdqllsv
    dgrslvglsqeraaelmtrtssvvtlevakqgalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2mA (A:)
    mkepeiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaagdqllsv
    dgrslvglsqeraaelmtrtssvvtlevakqga