PDB entry 1t2k

View 1t2k on RCSB PDB site
Description: Structure Of The DNA Binding Domains Of IRF3, ATF-2 and Jun Bound To DNA
Class: Transcription/DNA
Keywords: PROTEIN DNA COMPLEX, transcription
Deposited on 2004-04-21, released 2004-11-16
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.257
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon regulatory factor 3
    Species: HOMO SAPIENS
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t2ka_
  • Chain 'B':
    Compound: Interferon regulatory factor 3
    Species: HOMO SAPIENS
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t2kb_
  • Chain 'C':
    Compound: Transcription factor AP-1
    Species: HOMO SAPIENS
    Gene: JUN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05412 (0-61)
      • cloning artifact (0)
      • engineered (16)
    Domains in SCOP 1.75: d1t2kc_
  • Chain 'D':
    Compound: Cyclic-AMP-dependent transcription factor ATF-2
    Species: HOMO SAPIENS
    Gene: ATF2, CREB2, CREBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15336 (0-60)
      • engineered (15)
    Domains in SCOP 1.75: d1t2kd_
  • Chain 'E':
    Compound: 31-mer
  • Chain 'F':
    Compound: 31-mer
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t2kA (A:)
    mgtpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaea
    tgayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2kA (A:)
    tpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatg
    ayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t2kB (B:)
    mgtpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaea
    tgayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2kB (B:)
    pkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatga
    yvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t2kC (C:)
    mkaerkrmrnriaasksrkrkleriarleekvktlkaqnselastanmlreqvaqlkqkv
    mn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t2kD (D:)
    krrkflernraaasrsrqkrkvwvqslekkaedlsslngqlqsevtllrnevaqlkqlll
    a
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.