PDB entry 1t2i

View 1t2i on RCSB PDB site
Description: T76W mutant of RNase Sa from Streptomyces aureofaciens
Class: hydrolase
Keywords: mutant, ribonuclease, HYDROLASE
Deposited on 2004-04-21, released 2004-12-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.13
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: guanyl-specific ribonuclease sa
  Species: Streptomyces aureofaciens [TaxId:1894]
  Gene: U39467
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05798 (0-95)
    • engineered (75)
  Domains in SCOPe 2.05: d1t2ia_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1t2iA (A:)
  dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
  gartrgtrriitgeawqedyytgdhyatfslidqtc