PDB entry 1t2i

View 1t2i on RCSB PDB site
Description: T76W mutant of RNase Sa from Streptomyces aureofaciens
Class: hydrolase
Keywords: mutant, ribonuclease
Deposited on 2004-04-21, released 2004-12-21
The last revision prior to the SCOP 1.73 freeze date was dated 2004-12-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.13
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: guanyl-specific ribonuclease sa
  Species: Streptomyces aureofaciens
  Gene: U39467
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05798 (0-95)
    • engineered (75)
  Domains in SCOP 1.73: d1t2ia_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1t2iA (A:)
  dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
  gartrgtrriitgeawqedyytgdhyatfslidqtc