PDB entry 1t2i

View 1t2i on RCSB PDB site
Description: t76w mutant of rnase sa from streptomyces aureofaciens
Deposited on 2004-04-21, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.13
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1t2ia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1t2iA (A:)
  dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
  gartrgtrriitgeawqedyytgdhyatfslidqtc