PDB entry 1t2h

View 1t2h on RCSB PDB site
Description: Y81W mutant of RNase Sa from Streptomyces aureofaciens
Class: hydrolase
Keywords: mutant, ribonuclease, HYDROLASE
Deposited on 2004-04-21, released 2004-12-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.146
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: U39467
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • engineered (80)
    Domains in SCOPe 2.05: d1t2ha_
  • Chain 'B':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: U39467
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • engineered (80)
    Domains in SCOPe 2.05: d1t2hb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t2hA (A:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedywtgdhyatfslidqtc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t2hB (B:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedywtgdhyatfslidqtc