PDB entry 1t2a

View 1t2a on RCSB PDB site
Description: Crystal structure of human GDP-D-mannose 4,6-dehydratase
Class: structural genomics,lyase
Keywords: Structural Genomics Consortium, Rossman-fold, short-chain dehydrogenase/reductase, SDR, STRUCTURAL GENOMICS,LYASE
Deposited on 2004-04-20, released 2004-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.173
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-mannose 4,6 dehydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: GMDS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t2aa_
  • Chain 'B':
    Compound: GDP-mannose 4,6 dehydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: GMDS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t2ab_
  • Chain 'C':
    Compound: GDP-mannose 4,6 dehydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: GMDS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t2ac_
  • Chain 'D':
    Compound: GDP-mannose 4,6 dehydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: GMDS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t2ad_
  • Heterogens: NDP, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t2aA (A:)
    mgsshhhhhhssgrenkyfqghmrnvalitgitgqdgsylaefllekgyevhgivrrsss
    fntgriehlyknpqahiegnmklhygdltdstclvkiinevkpteiynlgaqshvkisfd
    laeytadvdgvgtlrlldavktcglinsvkfyqastselygkvqeipqkettpfyprspy
    gaaklyaywivvnfreaynlfavngilfnhesprrganfvtrkisrsvakiylgqlecfs
    lgnldakrdwghakdyveamwlmlqndepedfviatgevhsvrefveksflhigktivwe
    gknenevgrcketgkvhvtvdlkyyrptevdflqgdctkakqklnwkprvafdelvremv
    hadvelmrtnpnags
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2aA (A:)
    rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlynmklhygdltdst
    clvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktcglinsvkfy
    qastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfavngilfnhes
    prrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlmlqndepedf
    viatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlkyyrptevdf
    lqgdctkakqklnwkprvafdelvremvhadvelmrtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t2aB (B:)
    mgsshhhhhhssgrenkyfqghmrnvalitgitgqdgsylaefllekgyevhgivrrsss
    fntgriehlyknpqahiegnmklhygdltdstclvkiinevkpteiynlgaqshvkisfd
    laeytadvdgvgtlrlldavktcglinsvkfyqastselygkvqeipqkettpfyprspy
    gaaklyaywivvnfreaynlfavngilfnhesprrganfvtrkisrsvakiylgqlecfs
    lgnldakrdwghakdyveamwlmlqndepedfviatgevhsvrefveksflhigktivwe
    gknenevgrcketgkvhvtvdlkyyrptevdflqgdctkakqklnwkprvafdelvremv
    hadvelmrtnpnags
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2aB (B:)
    rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlynmklhygdltdst
    clvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktcglinsvkfy
    qastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfavngilfnhes
    prrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlmlqndepedf
    viatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlkyyrptevdf
    lqgdctkakqklnwkprvafdelvremvhadvelmrtn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t2aC (C:)
    mgsshhhhhhssgrenkyfqghmrnvalitgitgqdgsylaefllekgyevhgivrrsss
    fntgriehlyknpqahiegnmklhygdltdstclvkiinevkpteiynlgaqshvkisfd
    laeytadvdgvgtlrlldavktcglinsvkfyqastselygkvqeipqkettpfyprspy
    gaaklyaywivvnfreaynlfavngilfnhesprrganfvtrkisrsvakiylgqlecfs
    lgnldakrdwghakdyveamwlmlqndepedfviatgevhsvrefveksflhigktivwe
    gknenevgrcketgkvhvtvdlkyyrptevdflqgdctkakqklnwkprvafdelvremv
    hadvelmrtnpnags
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2aC (C:)
    rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlynmklhygdltdst
    clvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktcglinsvkfy
    qastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfavngilfnhes
    prrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlmlqndepedf
    viatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlkyyrptevdf
    lqgdctkakqklnwkprvafdelvremvhadvelmrtn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t2aD (D:)
    mgsshhhhhhssgrenkyfqghmrnvalitgitgqdgsylaefllekgyevhgivrrsss
    fntgriehlyknpqahiegnmklhygdltdstclvkiinevkpteiynlgaqshvkisfd
    laeytadvdgvgtlrlldavktcglinsvkfyqastselygkvqeipqkettpfyprspy
    gaaklyaywivvnfreaynlfavngilfnhesprrganfvtrkisrsvakiylgqlecfs
    lgnldakrdwghakdyveamwlmlqndepedfviatgevhsvrefveksflhigktivwe
    gknenevgrcketgkvhvtvdlkyyrptevdflqgdctkakqklnwkprvafdelvremv
    hadvelmrtnpnags
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2aD (D:)
    rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlynmklhygdltdst
    clvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktcglinsvkfy
    qastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfavngilfnhes
    prrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlmlqndepedf
    viatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlkyyrptevdf
    lqgdctkakqklnwkprvafdelvremvhadvelmrt