PDB entry 1t26

View 1t26 on RCSB PDB site
Description: Plasmodium falciparum lactate dehydrogenase complexed with NADH and 4-hydroxy-1,2,5-thiadiazole-3-carboxylic acid
Class: oxidoreductase
Keywords: protein-ligand complex, OXIDOREDUCTASE
Deposited on 2004-04-20, released 2004-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27743 (Start-315)
      • expression tag (316)
    Domains in SCOPe 2.06: d1t26a1, d1t26a2, d1t26a3
  • Heterogens: NAI, GBD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t26A (A:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t26A (A:)
    pkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckvs
    gsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnafi
    ivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivgah
    gnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaaa
    iiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekakf
    deaiaetkrmkalah