PDB entry 1t25

View 1t25 on RCSB PDB site
Description: Plasmodium falciparum lactate dehydrogenase complexed with NADH and 3-hydroxyisoxazole-4-carboxylic acid
Class: oxidoreductase
Keywords: protein-ligand complex, OXIDOREDUCTASE
Deposited on 2004-04-20, released 2004-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.154
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t25a1, d1t25a2
  • Heterogens: NAI, GAG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t25A (A:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t25A (A:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
    iivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivga
    hgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaa
    aiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekak
    fdeaiaetkrmkala