PDB entry 1t1r

View 1t1r on RCSB PDB site
Description: Crystal Structure of the Reductoisomerase Complexed with a Bisphosphonate
Class: oxidoreductase
Keywords: three domains, oxidoreductase
Deposited on 2004-04-17, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: Escherichia coli [TaxId:562]
    Gene: IspC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45568 (1-397)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1t1ra1, d1t1ra2, d1t1ra3, d1t1ra4, d1t1ra5
  • Chain 'B':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: Escherichia coli [TaxId:562]
    Gene: IspC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45568 (1-397)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1t1rb1, d1t1rb2, d1t1rb3, d1t1rb4, d1t1rb5
  • Heterogens: SO4, IMB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t1rA (A:)
    gkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t1rB (B:)
    gkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas