PDB entry 1t1p

View 1t1p on RCSB PDB site
Description: nmr structure of human insulin mutant his-b10-asp, val-b12-thr, pro-b28-lys, lys-b29-pro, 15 structures
Class: hormone/growth factor
Keywords: Thr-B12-DKP-insulin, protein unfolding, insulin receptor, receptor binding
Deposited on 2004-04-16, released 2004-08-10
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-10, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1t1p.1
  • Chain 'B':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-29)
      • engineered (9)
      • engineered (11)
      • engineered (27-28)
    Domains in SCOP 1.73: d1t1p.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t1pA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t1pB (B:)
    fvnqhlcgsdltealylvcgergffytkpt