PDB entry 1t1m

View 1t1m on RCSB PDB site
Description: Binding position of ribosome recycling factor (RRF) on the E. coli 70S ribosome
Class: ribosome
Keywords: RRF binding position on the ribosome
Deposited on 2004-04-16, released 2004-06-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: EM
Resolution: 12 Å
R-factor: N/A
AEROSPACI score: -0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dodecamer fragment of double helix from 23S rRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'B':
    Compound: 42-mer fragment of double helix from 16S rRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'C':
    Compound: ribosome recycling factor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1t1mc_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t1mC (C:)
    mvnpfikeakekmkrtlekiedelrkmrtgkpspaileeikvdyygvptpvnqlatisis
    eertlvikpwdksvlsliekainasdlglnpindgnvirlvfpsptteqrekwvkkakei
    veegkiairnirreilkkikedqkeglipeddakrleneiqkltdefiekldevfeikke
    eimef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t1mC (C:)
    vnpfikeakekmkrtlekiedelrkmrtgkpspaileeikvdyygvptpvnqlatisise
    ertlvikpwdksvlsliekainasdlglnpindgnvirlvfpsptteqrekwvkkakeiv
    eegkiairnirreilkkikedqkeglipeddakrleneiqkltdefiekldevfeikkee
    imef