PDB entry 1t1j

View 1t1j on RCSB PDB site
Description: Crystal structure of genomics APC5043
Class: structural genomics, unknown function
Keywords: structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2004-04-16, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.202
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3M0 (7-124)
      • cloning artifact (6)
    Domains in SCOPe 2.07: d1t1ja1, d1t1ja2
  • Chain 'B':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3M0 (7-124)
      • cloning artifact (0-6)
    Domains in SCOPe 2.07: d1t1jb1, d1t1jb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t1jA (A:)
    nlyfqghmrkiflacpyshadaevveqrfracnevaativraghvvfsqvsmshpinlcl
    aeldraaigrlwapvdafymdhleelivldlpgwrdsagirremeffeaggqrvslwsev
    ehefr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t1jA (A:)
    hmrkiflacpyshadaevveqrfracnevaativraghvvfsqvsmshpinlclaeldra
    aigrlwapvdafymdhleelivldlpgwrdsagirremeffeaggqrvslwsevehefr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t1jB (B:)
    nlyfqghmrkiflacpyshadaevveqrfracnevaativraghvvfsqvsmshpinlcl
    aeldraaigrlwapvdafymdhleelivldlpgwrdsagirremeffeaggqrvslwsev
    ehefr