PDB entry 1t1i

View 1t1i on RCSB PDB site
Description: High Resolution Crystal Structure of Mutant W129A of Kumamolisin, a Sedolisin Type Proteinase (previously called Kumamolysin or KSCP)
Class: hydrolase
Keywords: serine-carboxyl proteinases, subtilases, catalytic mechanism, sedolisin, kumamolisin, hydrolase
Deposited on 2004-04-16, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.183
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kumamolisin
    Species: Bacillus sp. MN-32 [TaxId:198803]
    Gene: KSCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RR56 (0-End)
      • engineered (128)
    Domains in SCOPe 2.07: d1t1ia_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t1iA (A:)
    aaptaytpldvaqayqfpegldgqgqciaiielgggydetslaqyfaslgvsapqvvsvs
    vdgatnqptgdpngpdgeveldievagalapgakiavyfapntdagflnaittavhdpth
    kpsivsisaggpedswapasiaamnrafldaaalgvtvlaaagdsgstdgeqdglyhvdf
    paaspyvlacggtrlvasagrieretvwndgpdggstgggvsrifplpswqeranvppsa
    npgagsgrgvpdvagnadpatgyevvidgettviggtsavaplfaalvarinqklgkpvg
    ylnptlyqlppevfhditegnndianrariyqagpgwdpctglgspigirllqallpsas
    qaqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t1iA (A:)
    aaptaytpldvaqayqfpegldgqgqciaiielgggydetslaqyfaslgvsapqvvsvs
    vdgatnqptgdpngpdgeveldievagalapgakiavyfapntdagflnaittavhdpth
    kpsivsisaggpedswapasiaamnrafldaaalgvtvlaaagdsgstdgeqdglyhvdf
    paaspyvlacggtrlvasagrieretvwndgpdggstgggvsrifplpswqeranvppsa
    npgagsgrgvpdvagnadpatgyevvidgettviggtsavaplfaalvarinqklgkpvg
    ylnptlyqlppevfhditegnndianrariyqagpgwdpctglgspigirllqallp