PDB entry 1t1h

View 1t1h on RCSB PDB site
Description: NMR solution structure of the U box domain from AtPUB14, an armadillo repeat containing protein from Arabidopsis thaliana
Class: ligase
Keywords: ubiquitin ligase, e3 ligase, arabidopsis, u-box, nmr
Deposited on 2004-04-16, released 2004-08-03
The last revision prior to the SCOP 1.75 freeze date was dated 2004-09-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: armadillo repeat containing protein
  Species: Arabidopsis thaliana
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8VZ40 (5-77)
    • cloning artifact (0-4)
  Domains in SCOP 1.75: d1t1ha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1t1hA (A:)
  gspefpeyfrcpislelmkdpvivstgqtyerssiqkwldaghktcpksqetllhagltp
  nyvlkslialwcesngie