PDB entry 1t1f

View 1t1f on RCSB PDB site
Description: Crystal Structure of Native Antithrombin in its Monomeric Form
Class: blood clotting
Keywords: serine-cysteine proteinase inhibitor; thrombin; human; x-ray crystallography
Deposited on 2004-04-16, released 2005-10-04
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.225
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antithrombin-III
    Species: HOMO SAPIENS
    Gene: SERPINC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01008 (Start-431)
      • engineered (136)
      • engineered (316)
      • engineered (400)
    Domains in SCOP 1.73: d1t1fa1
  • Chain 'B':
    Compound: antithrombin-III
    Species: HOMO SAPIENS
    Gene: SERPINC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01008 (Start-431)
      • engineered (136)
      • engineered (316)
      • engineered (400)
    Domains in SCOP 1.73: d1t1fb1
  • Chain 'C':
    Compound: antithrombin-III
    Species: HOMO SAPIENS
    Gene: SERPINC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01008 (Start-431)
      • engineered (136)
      • engineered (316)
      • engineered (400)
    Domains in SCOP 1.73: d1t1fc1
  • Heterogens: IOD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t1fA (A:)
    hgspvdictakprdipmnpmciyrspekkatedegseqkipeatnrrvwelskansrfat
    tfyqhladskndndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqih
    fffaklncrlyrkankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenae
    qsraainkwvsnktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfy
    kadgescsasmmyqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekelt
    pevlqewldeleemmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrd
    dlyvsdafhkaflevneegseaaastavviagrslnpnrvcfkanrpflvfirevplnti
    ifmgrvanpcvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t1fA (A:)
    gspvdictakprdipmnpmciyreqkipeatnrrvwelskansrfattfyqhladskndn
    dniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyrk
    ankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsnk
    tegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadgescsasmmy
    qegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlqewldelee
    mmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddlyvsdafhkafl
    evneegseaaastavviagrslnpnrvcfkanrpflvfirevplntiifmgrvanpcvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t1fB (B:)
    hgspvdictakprdipmnpmciyrspekkatedegseqkipeatnrrvwelskansrfat
    tfyqhladskndndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqih
    fffaklncrlyrkankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenae
    qsraainkwvsnktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfy
    kadgescsasmmyqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekelt
    pevlqewldeleemmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrd
    dlyvsdafhkaflevneegseaaastavviagrslnpnrvcfkanrpflvfirevplnti
    ifmgrvanpcvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t1fB (B:)
    gspvdictakprdipmnpmciyreqkipeatnrrvwelskansrfattfyqhladskndn
    dniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyrk
    ankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsnk
    tegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadgescsasmmy
    qegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlqewldelee
    mmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddlyvsdafhkafl
    evneegseaaastavviagrslnpnrvcfkanrpflvfirevplntiifmgrvanpcvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t1fC (C:)
    hgspvdictakprdipmnpmciyrspekkatedegseqkipeatnrrvwelskansrfat
    tfyqhladskndndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqih
    fffaklncrlyrkankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenae
    qsraainkwvsnktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfy
    kadgescsasmmyqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekelt
    pevlqewldeleemmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrd
    dlyvsdafhkaflevneegseaaastavviagrslnpnrvcfkanrpflvfirevplnti
    ifmgrvanpcvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t1fC (C:)
    gspvdictakprdipmnpmciyreqkipeatnrrvwelskansrfattfyqhladskndn
    dniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyrk
    ankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsnk
    tegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadgescsasmmy
    qegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlqewldelee
    mmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddlyvsdafhkafl
    evneegseaaastavviagrslnpnrvcfkanrpflvfirevplntiifmgrvanpcvk