PDB entry 1t1e

View 1t1e on RCSB PDB site
Description: High Resolution Crystal Structure of the Intact Pro-Kumamolisin, a Sedolisin Type Proteinase (previously called Kumamolysin or KSCP)
Class: hydrolase
Keywords: proenzyme, prosubtilase, activation mechanism, sedolisin, serine-carboxyl proteinase, HYDROLASE
Deposited on 2004-04-16, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: 0.213
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kumamolisin
    Species: Bacillus sp. MN-32 [TaxId:198803]
    Gene: KSCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RR56
      • conflict (159)
      • engineered (465)
    Domains in SCOPe 2.07: d1t1ea1, d1t1ea2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t1eA (A:)
    msdmekpwkeeekrevlagharrqapqavdkgpvtgdqrisvtvvlrrqrgdeleahver
    qaalapharvhlereafaashgaslddfaeirkfaeahgltldrahvaagtavlsgpvda
    vnqafgvelrhfdhpdgsyrsyvgdvrvpasiaplieavlgldtrpvarphfrlrrraeg
    efearsqsaaptaytpldvaqayqfpegldgqgqciaiielgggydetslaqyfaslgvs
    apqvvsvsvdgatnqptgdpngpdgeveldievagalapgakiavyfapntdagflnait
    tavhdpthkpsivsiswggpedswapasiaamnrafldaaalgvtvlaaagdsgstdgeq
    dglyhvdfpaaspyvlacggtrlvasagrieretvwndgpdggstgggvsrifplpswqe
    ranvppsanpgagsgrgvpdvagnadpatgyevvidgettviggtaavaplfaalvarin
    qklgkpvgylnptlyqlppevfhditegnndianrariyqagpgwdpctglgspigirll
    qallpsasqaqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t1eA (A:)
    ekrevlagharrqapqavdkgpvtgdqrisvtvvlrrqrgdeleahverqaalapharvh
    lereafaashgaslddfaeirkfaeahgltldrahvaagtavlsgpvdavnqafgvelrh
    fdhpdgsyrsyvgdvrvpasiaplieavlgldtrpvarphfrlrrraegefearsqsaap
    taytpldvaqayqfpegldgqgqciaiielgggydetslaqyfaslgvsapqvvsvsvdg
    atnqptgdpngpdgeveldievagalapgakiavyfapntdagflnaittavhdpthkps
    ivsiswggpedswapasiaamnrafldaaalgvtvlaaagdsgstdgeqdglyhvdfpaa
    spyvlacggtrlvasagrieretvwndgpdggstgggvsrifplpswqeranvppsanpg
    agsgrgvpdvagnadpatgyevvidgettviggtaavaplfaalvarinqklgkpvgyln
    ptlyqlppevfhditegnndianrariyqagpgwdpctglgspigirllqallp