PDB entry 1t1d

View 1t1d on RCSB PDB site
Description: crystal structure of the tetramerization domain of the shaker potassium channel
Deposited on 1998-09-22, released 1999-01-13
The last revision prior to the SCOP 1.63 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.229
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1t1da_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1t1dA (A:)
  ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
  qsggrlrrpvnvpldvfseeikfyelgenaferyredegf