PDB entry 1t1b

View 1t1b on RCSB PDB site
Description: Late intermediate IL2 from time-resolved crystallography of the E46Q mutant of PYP
Class: photoreceptor
Keywords: photoactive yellow protein, PAS domain
Deposited on 2004-04-15, released 2005-01-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.318
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoactive yellow protein
    Species: Ectothiorhodospira halophila
    Gene: PYP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16113 (0-124)
      • engineered (45)
    Domains in SCOP 1.73: d1t1ba1
  • Heterogens: HC4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t1bA (A:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
    nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv