PDB entry 1t17

View 1t17 on RCSB PDB site
Description: Solution Structure of the 18 kDa Protein CC1736 from Caulobacter crescentus: The Northeast Structural Genomics Consortium Target CcR19
Class: structural genomics, unknown function
Keywords: beta-alpha-beta-beta-beta-beta-beta-beta-helix, structural genomics, protein structure initiative, PSI, NESG, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2004-04-15, released 2005-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: conserved hypothetical protein
  Species: CAULOBACTER CRESCENTUS [TaxId:190650]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9A7I7 (0-147)
  Domains in SCOPe 2.08: d1t17a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1t17A (A:)
  mhrhvvtkvlpytpdqlfelvgdvdaypkfvpwitgmrtwngrvdgavstvdaeaqvgfs
  flrekfatrvrrdkdarsidvsllygpfkrlnngwrfmpegdatrvefviefafksalld
  amlaanvdraagkliacfearaqqlhga