PDB entry 1t16

View 1t16 on RCSB PDB site
Description: Crystal structure of the bacterial fatty acid transporter FadL from Escherichia coli
Class: lipid transport
Keywords: beta-barrel, LIPID TRANSPORT
Deposited on 2004-04-15, released 2004-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.257
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Long-chain fatty acid transport protein
    Species: Escherichia coli [TaxId:562]
    Gene: FADL, TTR, B2344
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10384 (0-420)
      • expression tag (421-426)
    Domains in SCOPe 2.07: d1t16a1, d1t16a2
  • Chain 'B':
    Compound: Long-chain fatty acid transport protein
    Species: Escherichia coli [TaxId:562]
    Gene: FADL, TTR, B2344
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10384 (0-420)
      • expression tag (421-426)
    Domains in SCOPe 2.07: d1t16b1, d1t16b2
  • Heterogens: CU, LDA, C8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t16A (A:)
    agfqlnefsssglgraysgegaiaddagnvsrnpalitmfdrptfsagavyidpdvnisg
    tspsgrslkadniaptawvpnmhfvapindqfgwgasitsnyglatefndtyaggsvggt
    tdletmnlnlsgayrlnnawsfglgfnavyarakierfagdlgqlvagqimqspagqtqq
    gqalaatangidsntkiahlngnqwgfgwnagilyeldknnryaltyrsevkidfkgnys
    sdlnrafnnyglpiptatggatqsgyltlnlpemwevsgynrvdpqwaihyslaytswsq
    fqqlkatstsgdtlfqkhegfkdayrialgttyyyddnwtfrtgiafddspvpaqnrsis
    ipdqdrfwlsagttyafnkdasvdvgvsymhgqsvkinegpyqfesegkawlfgtnfnya
    fhhhhhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t16B (B:)
    agfqlnefsssglgraysgegaiaddagnvsrnpalitmfdrptfsagavyidpdvnisg
    tspsgrslkadniaptawvpnmhfvapindqfgwgasitsnyglatefndtyaggsvggt
    tdletmnlnlsgayrlnnawsfglgfnavyarakierfagdlgqlvagqimqspagqtqq
    gqalaatangidsntkiahlngnqwgfgwnagilyeldknnryaltyrsevkidfkgnys
    sdlnrafnnyglpiptatggatqsgyltlnlpemwevsgynrvdpqwaihyslaytswsq
    fqqlkatstsgdtlfqkhegfkdayrialgttyyyddnwtfrtgiafddspvpaqnrsis
    ipdqdrfwlsagttyafnkdasvdvgvsymhgqsvkinegpyqfesegkawlfgtnfnya
    fhhhhhh