PDB entry 1t14

View 1t14 on RCSB PDB site
Description: Crystal structure of LUSH from Drosophila melanogaster: apo protein
Class: transport protein
Keywords: lush, alcohol, odorant binding, transport protein
Deposited on 2004-04-15, released 2005-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.193
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lush
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: lush
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t14a_
  • Chain 'B':
    Compound: lush
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: lush
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t14b_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t14A (A:)
    mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
    kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
    fmwp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t14B (B:)
    mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
    kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
    fmwp