PDB entry 1t12

View 1t12 on RCSB PDB site
Description: Solution Structure of a new LTP1
Class: lipid transport
Keywords: cystein rich protein; lipid transfer protein, LIPID TRANSPORT
Deposited on 2004-04-15, released 2005-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nonspecific lipid-transfer protein 1
    Species: Nicotiana tabacum [TaxId:4097]
    Gene: LTP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t12a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t12A (A:)
    aitcgqvtsnlapclaylrntgplgrccggvkalvnsarttedrqiactclksaagaisg
    inlgkaaglpstcgvnipykispstdcskvq