PDB entry 1t10

View 1t10 on RCSB PDB site
Description: phosphoglucose isomerase from leishmania mexicana in complex with substrate d-fructose-6-phosphate
Deposited on 2004-04-14, released 2004-06-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.222
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t10a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t10A (A:)
    msdyfsklkehvvesteingctpsiatatfnapyevarktkmlgvtdssllnlpawkrlq
    slyekygndsilshfekdhqrfqrysieidlhsddnflfldyskshindeikdalvalae
    ergvrafakamfdgqrvnstenravlhvalrnrsnrpiivdgkdvmsdvnnvlaqmkdft
    ervrsgewkgqtgksiynivnigiggsdlgpvmvtealkpfskrdlhcffvsnvdgthma
    evlkqvnleetifiiasktfttqetltnamsarnalmsylkengistdgavakhfvalst
    ntekvrefgidtvnmfafwdwvggrysvwsaiglsvmlsigydnfvefltgahvmdnhfa
    stpteqnlpmmlalvgiwynnffgsetqavlpydqylwrlpaylqqldmesngkgvtkks
    gavavqtgpivfgeagtngqhafyqlihqgtkiipcdfigcvqtqnrvgdhhrtlmsnff
    aqtealmvgknaeevrqelvksgmsgdaienmiphktftgsrpsnsilvnaltpralgai
    iamyehkvlvqgaiwginsydqwgvelgkvlaksilpqlksgnivsdhdgstnglinmfn
    trahl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t10A (A:)
    sllnlpawkrlqslyekygndsilshfekdhqrfqrysieidlhsddnflfldyskshin
    deikdalvalaeergvrafakamfdgqrvnstenravlhvalrnrsnrpiivdgkdvmsd
    vnnvlaqmkdftervrsgewkgqtgksiynivnigiggsdlgpvmvtealkpfskrdlhc
    ffvsnvdgthmaevlkqvnleetifiiasktfttqetltnamsarnalmsylkengistd
    gavakhfvalstntekvrefgidtvnmfafwdwvggrysvwsaiglsvmlsigydnfvef
    ltgahvmdnhfastpteqnlpmmlalvgiwynnffgsetqavlpydqylwrlpaylqqld
    mesngkgvtkksgavavqtgpivfgeagtngqhafyqlihqgtkiipcdfigcvqtqnrv
    gdhhrtlmsnffaqtealmvgknaeevrqelvksgmsgdaienmiphktftgsrpsnsil
    vnaltpralgaiiamyehkvlvqgaiwginsydqwgvelgkvlaksilpqlksgnivsdh
    dgstnglinmfntrah