PDB entry 1t0y

View 1t0y on RCSB PDB site
Description: solution structure of a ubiquitin-like domain from tubulin-binding cofactor b
Deposited on 2004-04-13, released 2004-04-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-27, with a file datestamp of 2004-04-27.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1t0ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t0yA (A:)
    gsmtevydleittnatdfpmekkypagmslndlkkklelvvgttvdsmriqlfdgddqlk
    geltdgakslkdlgvrdgyrihavdvtggnedfkdesmvekyemsddtygkrtdsvrawk
    kk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0yA (A:)
    mtevydleittnatdfpmekkypagmslndlkkklelvvgttvdsmriqlfdgddqlkge
    ltdgakslkdlgvrdgyrihavdvtggned